Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLPS, Rat (HEK293, His)

CLPS protein activates enzymes, regulates catalytic activity, and responds to food.It is located extracellularly and may play a role in type 2 diabetes.CLPS expression is tissue-specific, with a high expression level of RPKM 1512.3.CLPS Protein, Rat (HEK293, His) is the recombinant rat-derived CLPS protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CLPS Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clps-protein-rat-hek293-his.html

Purity

98.0

Smiles

APGPRGLFINLEDGEICVNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGVCLDSTRSKQ

Molecular Formula

25680 (Gene_ID) NP_037271 (A18-Q112) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS10 Protein Vector (Mouse) (pPM-C-HA)
PV152388 500 ng

ADAMTS10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GGT1 (Gamma-glutamyltranspeptidase 1, GGT, GTG, CD224, GGT 1, D22S672, D22S732) (Biotin)
MBS6418413-01 0.1 mL

GGT1 (Gamma-glutamyltranspeptidase 1, GGT, GTG, CD224, GGT 1, D22S672, D22S732) (Biotin)

Sign In for Pricing
View Details
GGT1 (Gamma-glutamyltranspeptidase 1, GGT, GTG, CD224, GGT 1, D22S672, D22S732) (Biotin)
MBS6418413-02 5x 0.1 mL

GGT1 (Gamma-glutamyltranspeptidase 1, GGT, GTG, CD224, GGT 1, D22S672, D22S732) (Biotin)

Sign In for Pricing
View Details
CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200)
C2399-01B 100 µL

CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200)

Sign In for Pricing
View Details
RBM44 CRISPR All-in-one AAV vector set (with saCas9)(Human)
38636151 3x 1.0 µg DNA

RBM44 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
ERLIN1 Antibody
CSB-PA007790LA01HU-01 50 µg

ERLIN1 Antibody

Sign In for Pricing
View Details