Anti-Agouti related protein (AGRP) Antibody

AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.

Our Anti-Agouti related protein (AGRP) guinea pig polyclonal primary antibody detects human, mouse, rat, and sheep Agouti related protein (AGRP), and is whole serum. It is validated for use in IHC-Frozen.

A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.

Spin vial briefly before opening. Reconstitute in 50 μL sterile-filtered, ultrapure water. Centrifuge to remove any insoluble material. Store lyophilized antibody at 2-8°C or lower. After reconstitution, divide into aliquots and store at -20°C, or lower, for optimal long term stability. It is recommended that a reconstituted aliquot is stored at 2-8°C for no longer than 2 weeks. Allocation of an appropriate anti-bacterial agent can increase shelf life by several weeks. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.

Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.