Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-Agouti related protein (AGRP) Antibody

Our Anti-Agouti related protein (AGRP) guinea pig polyclonal primary antibody detects human, mouse, rat, and sheep Agouti related protein (AGRP), and is whole serum. It is validated for use in IHC-Frozen.

Product Specifications

Background

AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.

Short Description

Our Anti-Agouti related protein (AGRP) guinea pig polyclonal primary antibody detects human, mouse, rat, and sheep Agouti related protein (AGRP), and is whole serum. It is validated for use in IHC-Frozen.

Synonyms

Agrp; Agrt; Art; Agouti-related protein

UniProt

P56473

Reactivity

Human, Mouse, Rat, and Sheep

Immunogen

A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.

Target

Agouti related protein (AGRP)

Clonality

Polyclonal

Conjugation

Unconjugated

Applications

IHC-Frozen

Format

Whole serum

Precautions

For research use only.

Shipping Conditions

25°C (ambient)

Storage Conditions

Spin vial briefly before opening. Reconstitute in 50 μL sterile-filtered, ultrapure water. Centrifuge to remove any insoluble material. Store lyophilized antibody at 2-8°C or lower. After reconstitution, divide into aliquots and store at -20°C, or lower, for optimal long term stability. It is recommended that a reconstituted aliquot is stored at 2-8°C for no longer than 2 weeks. Allocation of an appropriate anti-bacterial agent can increase shelf life by several weeks. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.

Notes

Neat serum

IHC Dilution

1:1000-1:2000

Specificity

Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.

Host or Source

Guinea Pig

Physical Properties

Lyophilized

Isotype

Mixed

Immunogen Species

Mouse

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-500 1x 500 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details