Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant BAFF (B-cell activating factor) protein, AF

BAFF also known as BLYS, TALL-1 and TNFSF13B, which belongs to tumor necrosis factor family. BAFF is a 31.2 kDa type II transmembrane protein containing 285 residues that predominantly produced by myeloid cells, furthermore mouse BAFF shares 72% sequence identity with human BAFF. BAFF has been demonstrated to activate the survival of B cells and the B cell response by binding to BAFFR/BR3. Additionally, BAFF also takes part in regulating B and T cell function via forming two ligands-two receptors pathway through sharing TNFRSF13B/TACI and TNFRSF17/BCMA receptors with APRIL.

Product Specifications

Synonyms

Tumor necrosis factor (ligand) superfamily, member 13b, Tnfsf13b, BAF, BL, BLyS, D8Ertd387, D8Ertd387e, TAL, TALL-1, TALL1, THANK, TNFSF20, Tnlg7a, zTNF, zTNF4

Gene Name

TNFSF13B

UniProt

Q9WU72

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in mouse B cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 21.56 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAE2 / UBA2 Rabbit pAb, PE-Cy7 conjugated
orb2840800 100 µL

SAE2 / UBA2 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Lentiviral human PPP2CB shRNA (UAS) - Lentiviral human PPP2CB shRNA (UAS, iRFP) plasmid
GTR15120508 1 Vial

Lentiviral human PPP2CB shRNA (UAS) - Lentiviral human PPP2CB shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PCMV-EGFP-SIRT2-3xFLAG-Neo Plasmid
PVT77616 2 µg

PCMV-EGFP-SIRT2-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
Osteoactivin/GPNMB Protein, Human, Recombinant (hFc)
TMPY-03402-01 5 µg

Osteoactivin/GPNMB Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
Osteoactivin/GPNMB Protein, Human, Recombinant (hFc)
TMPY-03402-02 10 µg

Osteoactivin/GPNMB Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
Osteoactivin/GPNMB Protein, Human, Recombinant (hFc)
TMPY-03402-03 20 µg

Osteoactivin/GPNMB Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details