Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant BAFF (B-cell activating factor) protein, AF

BAFF also known as BLYS, TALL-1 and TNFSF13B, which belongs to tumor necrosis factor family. BAFF is a 31.2 kDa type II transmembrane protein containing 285 residues that predominantly produced by myeloid cells, furthermore mouse BAFF shares 72% sequence identity with human BAFF. BAFF has been demonstrated to activate the survival of B cells and the B cell response by binding to BAFFR/BR3. Additionally, BAFF also takes part in regulating B and T cell function via forming two ligands-two receptors pathway through sharing TNFRSF13B/TACI and TNFRSF17/BCMA receptors with APRIL.

Product Specifications

Synonyms

Tumor necrosis factor (ligand) superfamily, member 13b, Tnfsf13b, BAF, BL, BLyS, D8Ertd387, D8Ertd387e, TAL, TALL-1, TALL1, THANK, TNFSF20, Tnlg7a, zTNF, zTNF4

Gene Name

TNFSF13B

UniProt

Q9WU72

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in mouse B cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 21.56 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)
TRV-0064207-01 24 Tests

ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)

Sign In for Pricing
View Details
ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)
TRV-0064207-02 48 Tests

ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)

Sign In for Pricing
View Details
ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)
TRV-0064207-03 96 Tests

ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)

Sign In for Pricing
View Details
ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)
TRV-0064207-04 5x 96 Tests

ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)

Sign In for Pricing
View Details
ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)
TRV-0064207-05 10x 96 Tests

ELISA Kit for Low Density Lipoprotein Receptor Related Protein 3 (LRP3)

Sign In for Pricing
View Details
Rat ErbB2 Recombinant Protein C-6 His Tag Lyophilized 50UG
IRTERBB2RC6HISLY50UG 50 µg

Rat ErbB2 Recombinant Protein C-6 His Tag Lyophilized 50UG

Sign In for Pricing
View Details