Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant AITRL (Activation-induced TNFR member ligand) protein, AF

AITRL also known as TNFSF18, GITRL and TL6, belonging to TNF superfamily. AITRL is a 20.3 kDa protein containing 177 residues that implicates in regulating immune systems. AITRL contributes to tumor suppression and the development of autoimmune diseases via interacting with TNFRSF18/AITR/GITR. Besides, AITRL-GITR signaling has been demonstrated to enhance phosphorylation of STAT1 and up-regulate expression of VCAM1 and ICAM1 in endothelial cells. Furthermore, AITRL can also facilitate the adhesion and transmigration of leukocytes to endothelial cells.

Product Specifications

Synonyms

TL6, GITRL, TNLG2A, hGITRL, TNFSF18

Gene Name

TNFSF18

UniProt

Q9UNG2

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in human PBMC using a concentration range of 5-200 ng /mL. Note: Result may vary from different PBMC donors.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 15.34 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGII LIANPQEI with polyhistidine tag at the C-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RBAK protein, His-tagged
RBAK-2726H 25 µg

Recombinant Human RBAK protein, His-tagged

Sign In for Pricing
View Details
CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (MaxLight 490)
MBS6200280-01 0.1 mL

CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (MaxLight 490)

Sign In for Pricing
View Details
CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (MaxLight 490)
MBS6200280-02 5x 0.1 mL

CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (MaxLight 490)

Sign In for Pricing
View Details
SEN3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV748151 1.0 µg DNA

SEN3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Ctdp1 Mouse shRNA Plasmid (Locus ID 67655)
TL514886 1 Kit

Ctdp1 Mouse shRNA Plasmid (Locus ID 67655)

Sign In for Pricing
View Details
Rat anti-nuclear factor Antibody ELISA Kit
EIA05283r 1 Kit

Rat anti-nuclear factor Antibody ELISA Kit

Sign In for Pricing
View Details