Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-19 (Interleukin-19) protein, AF

Interleukin 19 (IL-19) predicts a molecular mass of 35.8 kDa, is a type of anti-inflammatory cytokine. It promotes the Th2 T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and IFNγ secretion, increases IL-10 expression in peripheral blood mononuclear cells, and inhibits the production of IgG from B cells.

Product Specifications

Synonyms

Melanoma differentiation-associated protein-like protein

Gene Name

IL19

UniProt

Q9UHD0

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <1.2 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.69 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA with polyhistidinetag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100361488 3'UTR GFP Stable Cell Line
TU257968 1.0 mL

LOC100361488 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human CLCA1 Pre-designed siRNA Set B
SI003142B 1 Each

Human CLCA1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PPP4R3A Rabbit Polyclonal Antibody (FITC)
orb2101227 100 µL

PPP4R3A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
POLA2 (Polymerase (DNA-directed), alpha 2, 70kD Subunit) (MaxLight 550)
MBS6432102-01 0.1 mL

POLA2 (Polymerase (DNA-directed), alpha 2, 70kD Subunit) (MaxLight 550)

Sign In for Pricing
View Details
POLA2 (Polymerase (DNA-directed), alpha 2, 70kD Subunit) (MaxLight 550)
MBS6432102-02 5x 0.1 mL

POLA2 (Polymerase (DNA-directed), alpha 2, 70kD Subunit) (MaxLight 550)

Sign In for Pricing
View Details
AF488 Anti-Human CD57 Antibody
DL20836F-01 20 Tests

AF488 Anti-Human CD57 Antibody

Sign In for Pricing
View Details