Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-19 (Interleukin-19) protein, AF

Interleukin 19 (IL-19) predicts a molecular mass of 35.8 kDa, is a type of anti-inflammatory cytokine. It promotes the Th2 T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and IFNγ secretion, increases IL-10 expression in peripheral blood mononuclear cells, and inhibits the production of IgG from B cells.

Product Specifications

Synonyms

Melanoma differentiation-associated protein-like protein

Gene Name

IL19

UniProt

Q9UHD0

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <1.2 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.69 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA with polyhistidinetag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Complement Factor P (CFP) ELISA Kit
RD-CFP-Hu-01 96 Tests

Human Complement Factor P (CFP) ELISA Kit

Sign In for Pricing
View Details
Human Complement Factor P (CFP) ELISA Kit
RD-CFP-Hu-02 48 Tests

Human Complement Factor P (CFP) ELISA Kit

Sign In for Pricing
View Details
HECTD2 (NM_182765) Human Recombinant Protein
TP307254L 1 mg

HECTD2 (NM_182765) Human Recombinant Protein

Sign In for Pricing
View Details
CT47A3 (NM_001080144) Human Over-expression Lysate
LY421600 100 µg

CT47A3 (NM_001080144) Human Over-expression Lysate

Sign In for Pricing
View Details
Sutimlimab Biosimilar - Research Grade
ICH5012-10mg 10 mg (2x 5 mg)

Sutimlimab Biosimilar - Research Grade

Sign In for Pricing
View Details
2,3-Difluorophenyl Efinaconazole Diol
TRC-E427000-50MG 50 mg

2,3-Difluorophenyl Efinaconazole Diol

Sign In for Pricing
View Details