Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-36 alpha (Interleukin-36 alpha) protein, AF

Interleukin-36 alpha (IL-36α) is an 18 kDa cytokine with 154 amino acid residues. IL-36α is one of the IL-36 agonists secreted from keratinocytes. When IL-36α binds to the IL-36 receptor, it activates NF-κB and MAPK signaling pathways that induce inflammatory responses. In addition, it also stimulates the production of inflammatory cytokines, such as IFN-γ, TNF-α, and IL-6.

Product Specifications

Synonyms

IL36A, Interleukin-1 family member 6 (IL-1F6), FIL1ε (FIL1E), Interleukin-1ε (IL1E)

Gene Name

IL36A

UniProt

Q9UHA7

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.7 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.05 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Anti-Human CD35 Antibody[E11]
E-AB-F1062G-01 20 Tests

PE/Cyanine5 Anti-Human CD35 Antibody[E11]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD35 Antibody[E11]
E-AB-F1062G-02 100 Tests

PE/Cyanine5 Anti-Human CD35 Antibody[E11]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD35 Antibody[E11]
E-AB-F1062G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD35 Antibody[E11]

Sign In for Pricing
View Details
Mouse Collagen Type X (COL10) ELISA Kit
RD-COL10-Mu-01 96 Tests

Mouse Collagen Type X (COL10) ELISA Kit

Sign In for Pricing
View Details
Mouse Collagen Type X (COL10) ELISA Kit
RD-COL10-Mu-02 48 Tests

Mouse Collagen Type X (COL10) ELISA Kit

Sign In for Pricing
View Details
Synaptotagmin VI (SYT6) Rabbit Polyclonal Antibody
TA362785 100 µL

Synaptotagmin VI (SYT6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details