Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant LIGHT protein, AF

LIGHT, also known as TNFSF14 is a member of the TNF superfamily that produced by multiple immune cells such as activated T cells and immature dendritic cells (DCs) . Mouse LIGHT shares 79% sequence homology with human LIGHT. LIGHT is a 29 kDa type II transmembrane protein, which serves as a ligand for both lymphotoxin β receptor (LTβR) and TNFSF signaling receptors (TNFRSF14/HVEM) . Besides, LIGHT can amplify NF-kB signaling pathway in T cells when presencing anti-CD3 antibody treatment. Additionally, LIGHT is able to stimulate T cell proliferation and IFN expression via interacting with TNFRS13 /HVEM.

Product Specifications

Synonyms

TNFSF14, HVEM-L, CD258, Ly113, LTg

Gene Name

Tnfsf14

UniProt

Q9QYH9

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce cytotoxicity in HT-29 cells. The ED50 for this effect is <2 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.92 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPNE6 Polyclonal Antibody
MBS2560518-01 0.02 mL

CPNE6 Polyclonal Antibody

Sign In for Pricing
View Details
CPNE6 Polyclonal Antibody
MBS2560518-02 0.06 mL

CPNE6 Polyclonal Antibody

Sign In for Pricing
View Details
CPNE6 Polyclonal Antibody
MBS2560518-03 0.12 mL

CPNE6 Polyclonal Antibody

Sign In for Pricing
View Details
CPNE6 Polyclonal Antibody
MBS2560518-04 0.2 mL

CPNE6 Polyclonal Antibody

Sign In for Pricing
View Details
CPNE6 Polyclonal Antibody
MBS2560518-05 5x 0.2 mL

CPNE6 Polyclonal Antibody

Sign In for Pricing
View Details
ABCG5 (Biotin)
554083-01 50 µg

ABCG5 (Biotin)

Sign In for Pricing
View Details