Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-17B (Interleukin-17B) protein, AF

Interleukin 17B (IL-17B) predicts a molecular mass of 20.4 kDa, is expressed in several peripheral tissues and immune tissues. In contrast to the high level of IL-6 secretion stimulated by IL-17A, IL-17B failed to induce IL-6 secretion in fibroblasts; however, it significantly enhanced the TNF-α-induced production of G-CSF and IL-6 in the fibroblasts.

Product Specifications

Synonyms

1110006O16Rik, 1700006N07Rik, Zcyto, Zcyto7

Gene Name

Il17b

UniProt

Q9QXT6

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.99 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF1 (NM_005801) Human Over-expression Lysate
LY401762 100 µg

EIF1 (NM_005801) Human Over-expression Lysate

Sign In for Pricing
View Details
TM6SF1 Human Gene Knockout Kit (CRISPR)
KN424527 1 Kit

TM6SF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VSTM2B Human qPCR Primer Pair (XM_114022)
HP221097 200 Reactions

VSTM2B Human qPCR Primer Pair (XM_114022)

Sign In for Pricing
View Details
Tryptophan Hydroxylase (TPH1) (NM_004179) Human Over-expression Lysate
LY401344 100 µg

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Over-expression Lysate

Sign In for Pricing
View Details
ADRM1 (NM_007002) Human Over-expression Lysate
LY402072 100 µg

ADRM1 (NM_007002) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus and adnexa
CS703858 5x 5 µm

Tissue FFPE Sections, Uterus and adnexa

Sign In for Pricing
View Details