Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-17B (Interleukin-17B) protein, AF

Interleukin 17B (IL-17B) predicts a molecular mass of 20.4 kDa, is expressed in several peripheral tissues and immune tissues. In contrast to the high level of IL-6 secretion stimulated by IL-17A, IL-17B failed to induce IL-6 secretion in fibroblasts; however, it significantly enhanced the TNF-α-induced production of G-CSF and IL-6 in the fibroblasts.

Product Specifications

Synonyms

1110006O16Rik, 1700006N07Rik, Zcyto, Zcyto7

Gene Name

Il17b

UniProt

Q9QXT6

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.99 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT2 Antibody
F40226-0.08ML 0.08 mL

AKT2 Antibody

Sign In for Pricing
View Details
Cofilin Recombinant Rabbit monoclonal Antibody
HA750613 100 µL

Cofilin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Quinoline Yellow (Technical Grade)
TRC-Q990080-250MG 250 mg

Quinoline Yellow (Technical Grade)

Sign In for Pricing
View Details
Texas Red Conjugated Morniga G Lectin (black mulberry) -MNA-G-
T-9005-1 1 mg

Texas Red Conjugated Morniga G Lectin (black mulberry) -MNA-G-

Sign In for Pricing
View Details
A 77-1726
TRC-A771726-500MG 500 mg

A 77-1726

Sign In for Pricing
View Details
CD8 (C8/468), CF640R conjugate, 0.1mg/mL
BNC400468-100 1x 100 µL

CD8 (C8/468), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details