Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-36 gamma (Interleukin-36 gamma) protein, AF

Interleukin-36 gamma (IL-36γ) consists of 134 amino acids. IL-36γ is a member of the interleukin-1 cytokine family. It plays a significant role in immune responses, particularly in inflammatory reactions, which are essential for binding with interleukin-1 receptor and serves as receptor agonists, enabling cytokine activity and generating pro-inflammatory.

Product Specifications

Synonyms

IL-1F9, IL-1ε (epsilon), IL-1H1, L1RP2, IL-1RP2

Gene Name

IL36GUNQ2456/PRO5737

UniProt

Q9NZH8

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in A431 cells. The ED50 for this effect is <5 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 17.98 kDa. The protein migrates as19 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND with polyhistidine tag at the C-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Eotaxin 2, CCL24 ELISA KIT
E0068Ca-01 48 Well

Canine Eotaxin 2, CCL24 ELISA KIT

Sign In for Pricing
View Details
Canine Eotaxin 2, CCL24 ELISA KIT
E0068Ca-02 96 Well

Canine Eotaxin 2, CCL24 ELISA KIT

Sign In for Pricing
View Details
Canine Eotaxin 2, CCL24 ELISA KIT
E0068Ca-03 5x 96 Tests

Canine Eotaxin 2, CCL24 ELISA KIT

Sign In for Pricing
View Details
Canine Eotaxin 2, CCL24 ELISA KIT
E0068Ca-04 10x 96 Tests

Canine Eotaxin 2, CCL24 ELISA KIT

Sign In for Pricing
View Details
Mouse Platelet Activating Factor, Paf Elisa Kit
EKC37591 96 Tests

Mouse Platelet Activating Factor, Paf Elisa Kit

Sign In for Pricing
View Details
Human Tubulointerstitial nephritis antigen (TINAG) ELISA Kit
abx383771 96 Tests

Human Tubulointerstitial nephritis antigen (TINAG) ELISA Kit

Sign In for Pricing
View Details