Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF

Interleukin-36 beta (IL-36β) is an 18 kDa cytokine with 154 amino acid residues. IL-36β, the ligand of IL-36R, is expressed in keratinocytes and plays a significant role in inflammatory responses. IL-36β regulates biological functions like the differentiation of T cells. Moreover, IL-36β recruits neutrophils via inducing the expression of cytokines and chemokines, such as IL-17C, granulocyte colony-stimulating factor (G-CSF), IL-8, CXCL-1, and tumor necrosis factor (TNF) .

Product Specifications

Synonyms

IL-1F8, IL-1H2, IL-1 eta

Gene Name

IL36B

UniProt

Q9NZH7

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.2 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.17 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp873 Mouse Gene Knockout Kit (CRISPR)
KN520017 1 Kit

Zfp873 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C12orf71 (NM_001080406) Human Over-expression Lysate
LY421623 100 µg

C12orf71 (NM_001080406) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC32A1 Antibody
KC-1242-01 50 μL

SLC32A1 Antibody

Sign In for Pricing
View Details
SLC32A1 Antibody
KC-1242-02 100 µL

SLC32A1 Antibody

Sign In for Pricing
View Details
SLC32A1 Antibody
KC-1242-03 1 mL

SLC32A1 Antibody

Sign In for Pricing
View Details
2-Linoleoyl-rac-glycerol-d5 O-TBS
TRC-L467966-5MG 5 mg

2-Linoleoyl-rac-glycerol-d5 O-TBS

Sign In for Pricing
View Details