Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant FGF-21 (Fibroblast growth factor-21) protein, AF

Fibroblast Growth Factors-21 (FGF-21) is a 22.3 kDa member of the fibroblast Growth Factors with 209 amino acid residues. FGF-21 is expressed from liver and cardiomyocytes. FGF-21 is a key protein that regulates important metabolic pathways, and modulates cellular function, metabolism, and senescence. It can stimulate glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1 /GLUT1 expression.

Product Specifications

Synonyms

FGFL

Gene Name

FGF21

UniProt

Q9NSA1

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in BaF3 cells transfected with human FGFRIIIc. The ED50 for this effect is <0.4 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.35 kDa. The protein migrates as 25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S-(2-Aminoethyl)-ITU dihydrobromide
TRC-A622688-25MG 25 mg

S-(2-Aminoethyl)-ITU dihydrobromide

Sign In for Pricing
View Details
FITC Conjugated Calystega sepiem Lectin (Hedge Bindweed Rhizomes) -Calsepa-
F-8011-1 1 mg

FITC Conjugated Calystega sepiem Lectin (Hedge Bindweed Rhizomes) -Calsepa-

Sign In for Pricing
View Details
Itga4 Rat Monoclonal Antibody [Clone ID: R1-2]
CL030RX 300 µg

Itga4 Rat Monoclonal Antibody [Clone ID: R1-2]

Sign In for Pricing
View Details
CLEC12B (NM_001129998) Human Recombinant Protein
TP325378M 100 µg

CLEC12B (NM_001129998) Human Recombinant Protein

Sign In for Pricing
View Details
Eribulin Dimer Impurity
TRC-E214620-0.5MG 0.5 mg

Eribulin Dimer Impurity

Sign In for Pricing
View Details
Spastin (Sp 6C6), CF405S conjugate, 0.1mg/mL
BNC043070-100 1x 100 µL

Spastin (Sp 6C6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details