Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant FGF-20 (Fibroblast growth factor-20) protein, AF

Fibroblast Growth Factors-20 (FGF-20) is a 23.5 kDa member of the fibroblast Growth Factors with 211 amino acid residues. FGF-20 is mainly expressed from microglial cells. FGF-20 can regulate central nervous development and function, regulate the survival of dopaminergic neurons via FGF/FGFR-dependent signaling pathway.

Product Specifications

Synonyms

FGFK

Gene Name

FGF20

UniProt

Q9NP95

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1.3-3.2 ng/mL. The specific activity of recombinant human FGF-20 is > 2 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 24.24 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic Anhydrase IX (CA9) Human Knockdown Lysate
LY300329 100 µg

Carbonic Anhydrase IX (CA9) Human Knockdown Lysate

Sign In for Pricing
View Details
Hieff Canace™ Uracil+ High-Fidelity DNA polymerase (1 U/μL)
10145ES76 500 U

Hieff Canace™ Uracil+ High-Fidelity DNA polymerase (1 U/μL)

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
KC-3023-01 50 μL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
KC-3023-02 100 µL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
KC-3023-03 1 mL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific,  40nm
GAF-512-40 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific, 40nm

Sign In for Pricing
View Details