Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant FGF-20 (Fibroblast growth factor-20) protein, AF

Fibroblast Growth Factors-20 (FGF-20) is a 23.5 kDa member of the fibroblast Growth Factors with 211 amino acid residues. FGF-20 is mainly expressed from microglial cells. FGF-20 can regulate central nervous development and function, regulate the survival of dopaminergic neurons via FGF/FGFR-dependent signaling pathway.

Product Specifications

Synonyms

FGFK

Gene Name

FGF20

UniProt

Q9NP95

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1.3-3.2 ng/mL. The specific activity of recombinant human FGF-20 is > 2 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 24.24 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 450 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Human FOXN4 activation kit by CRISPRa
GA114760 1 Kit

Human FOXN4 activation kit by CRISPRa

Sign In for Pricing
View Details
Aniline Point Tester BPTL-275
BPTL-275 1 Unit

Aniline Point Tester BPTL-275

Sign In for Pricing
View Details
Human Afamin (AFM) ELISA Kit
RD-AFM-Hu-01 96 Tests

Human Afamin (AFM) ELISA Kit

Sign In for Pricing
View Details