Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-36 alpha (Interleukin-36 alpha) protein, AF

Interleukin 36 alpha (IL-36 alpha) is a 17.76 kDa cytokine with 160 amino acid residues. IL-36 alpha is an IL-1 family member, which binds to the Interleukin-1 receptor and is expressed in the lung, stomach, and placenta. IL-36 alpha is critical in inflammatory responses and stimulates the production of proinflammatory cytokines, such as IL-12, IL-1β, IL-6, and TNF-α. It also induces the generation of IFNγ, IL-4, and IL-17 in CD4+ T cells.

Product Specifications

Synonyms

IL36A, Interleukin-1 family member 6 (IL-1F6), FIL1ε (FIL1E), Interleukin-1ε (IL1E), Fi, Fil, Fil1, IL-1, IL-1H1, IL1RP2

Gene Name

Il36a

UniProt

Q9JLA2

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is > 1 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.82 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUCB2 Antibody
KC-1435-01 50 μL

NUCB2 Antibody

Sign In for Pricing
View Details
NUCB2 Antibody
KC-1435-02 100 µL

NUCB2 Antibody

Sign In for Pricing
View Details
NUCB2 Antibody
KC-1435-03 1 mL

NUCB2 Antibody

Sign In for Pricing
View Details
MTMR9 (NM_015458) Human Over-expression Lysate
LC402438 20 µg

MTMR9 (NM_015458) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Gastroesophageal junction
CS628135 5x 5 µm

Frozen Tissue Sections, Gastroesophageal junction

Sign In for Pricing
View Details
FAM13C1 (FAM13C) (NM_001001971) Human Over-expression Lysate
LC424301 20 µg

FAM13C1 (FAM13C) (NM_001001971) Human Over-expression Lysate

Sign In for Pricing
View Details