Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-22 (Interleukin-22) protein, AF

Interleukin 22 (IL-22) is an α-helical cytokine, predicts a molecular mass of 16.9 kDa. It is produced by T-helper (Th) -17 cells, γδ T cells, NKT cells and newly described innate lymphoid cells (ILCs) . Effects involve stimulation of cell survival, proliferation and synthesis of antimicrobials including S110, Reg3β, Reg3γ and defensins.

Product Specifications

Synonyms

IL-TIF, Cytokine ZCYTO18, If2b1, ILTIFa

Gene Name

Il22

UniProt

Q9JJY9

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-10 secretion in COLO205 cells. The ED50 for this effect is <0.3 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 17.58 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody
TA369318 100 µL

Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF488A conjugate, 0.1mg/mL
BNC882939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Helix aspersa Lectin (Garden Snail) -HAA-,  30nm
GP-3801-30 1 mL

Colloidal Gold Conjugated Helix aspersa Lectin (Garden Snail) -HAA-, 30nm

Sign In for Pricing
View Details
CD117 (KIT/982), CF640R conjugate, 0.1mg/mL
BNC400982-500 1x 500 µL

CD117 (KIT/982), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLEKHF2 Rabbit Polyclonal Antibody
TA362376 100 µL

PLEKHF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
8-Aminopyrene-1,3,6-trisulfonic Acid Trisodium Salt
TRC-A629045-25MG 25 mg

8-Aminopyrene-1,3,6-trisulfonic Acid Trisodium Salt

Sign In for Pricing
View Details