Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-22 (Interleukin-22) protein, AF

Interleukin 22 (IL-22) is an α-helical cytokine, predicts a molecular mass of 16.9 kDa. It is produced by T-helper (Th) -17 cells, γδ T cells, NKT cells and newly described innate lymphoid cells (ILCs) . Effects involve stimulation of cell survival, proliferation and synthesis of antimicrobials including S110, Reg3β, Reg3γ and defensins.

Product Specifications

Synonyms

IL-TIF, Cytokine ZCYTO18, If2b1, ILTIFa

Gene Name

Il22

UniProt

Q9JJY9

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-10 secretion in COLO205 cells. The ED50 for this effect is <0.3 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 17.58 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Prostaglandin E Synthase 2 (PTGES2) ELISA Kit
orb1948596-01 48 Tests

Human Prostaglandin E Synthase 2 (PTGES2) ELISA Kit

Sign In for Pricing
View Details
Human Prostaglandin E Synthase 2 (PTGES2) ELISA Kit
orb1948596-02 96 Tests

Human Prostaglandin E Synthase 2 (PTGES2) ELISA Kit

Sign In for Pricing
View Details
Tnnt3 (NM_011620) Mouse Tagged Lenti ORF Clone
MR221586L3 10 µg

Tnnt3 (NM_011620) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Antifade mounting medium (hardset)
ENZ-53002-M010 10 mL

Antifade mounting medium (hardset)

Sign In for Pricing
View Details
Osteocalcin, aa21-31 (Bone-Gla-Protein, BGP)
MBS6007444-01 0.1 mg

Osteocalcin, aa21-31 (Bone-Gla-Protein, BGP)

Sign In for Pricing
View Details
Osteocalcin, aa21-31 (Bone-Gla-Protein, BGP)
MBS6007444-02 5x 0.1 mg

Osteocalcin, aa21-31 (Bone-Gla-Protein, BGP)

Sign In for Pricing
View Details