Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-21 protein, GMP

Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family, which exerts pleiotropic immune regulations. IL-21 produced primarily by natural killer T (NKT) cells, T follicular helper (TFH) cells and TH17 cells. As a pleiotropic cytokine, IL-21 has been shown to regulate both innate and humoral immunity. It has potent inhibitory activity towards the activation and maturation of granulocyte-macrophage colony-stimulating factor (GM-CSF) -induced dendritic cells (DCs) . In B cells, IL-21 has a major role in the development of immunoglobulin responses. In T cells, it is required to facilitate the functional differentiation of several CD4+ T cell subsets. In addition, the ability of IL-21 to enhance the cytotoxic activity of both CD8+ T cells and NK cells makes it as a potential antitumor agent.

Product Specifications

Synonyms

Za11

Gene Name

IL21

UniProt

Q9HBE4

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell culture, ELISA

Purification

>95% as determined by SDS-PAGE analysis.

Endotoxin

<0.05 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <10 ng/mL.

Form

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.

Molecular Weight

The protein has a calculated MW of 16.2 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAP43 Antibody
KC-509-01 50 μL

GAP43 Antibody

Sign In for Pricing
View Details
GAP43 Antibody
KC-509-02 100 µL

GAP43 Antibody

Sign In for Pricing
View Details
GAP43 Antibody
KC-509-03 1 mL

GAP43 Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-,  15nm
GP-6701-15 1 mL

Colloidal Gold Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-, 15nm

Sign In for Pricing
View Details
USP39 antibody
FNab09332 100 µg

USP39 antibody

Sign In for Pricing
View Details
Mix-n-StainTM CF®594 Nanobody Thiol Labeling Kit, 1x (5-20ug) labeling
#92591 1 Kit

Mix-n-StainTM CF®594 Nanobody Thiol Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details