Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-21 protein, GMP

Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family, which exerts pleiotropic immune regulations. IL-21 produced primarily by natural killer T (NKT) cells, T follicular helper (TFH) cells and TH17 cells. As a pleiotropic cytokine, IL-21 has been shown to regulate both innate and humoral immunity. It has potent inhibitory activity towards the activation and maturation of granulocyte-macrophage colony-stimulating factor (GM-CSF) -induced dendritic cells (DCs) . In B cells, IL-21 has a major role in the development of immunoglobulin responses. In T cells, it is required to facilitate the functional differentiation of several CD4+ T cell subsets. In addition, the ability of IL-21 to enhance the cytotoxic activity of both CD8+ T cells and NK cells makes it as a potential antitumor agent.

Product Specifications

Synonyms

Za11

Gene Name

IL21

UniProt

Q9HBE4

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell culture, ELISA

Purification

>95% as determined by SDS-PAGE analysis.

Endotoxin

<0.05 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <10 ng/mL.

Form

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.

Molecular Weight

The protein has a calculated MW of 16.2 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vimentin (Mesenchymal Cell Marker) (VIM/3736), CF740 conjugate, 0.1mg/mL
BNC743736-500 1x 500 µL

Vimentin (Mesenchymal Cell Marker) (VIM/3736), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Acetyl-D-[1,2,3-13C3]neuraminic Acid
TRC-A187007-25MG 25 mg

N-Acetyl-D-[1,2,3-13C3]neuraminic Acid

Sign In for Pricing
View Details
Recombinant Rat ALCAM/CD166 Protein (His Tag)
PKSR030308 100 µg

Recombinant Rat ALCAM/CD166 Protein (His Tag)

Sign In for Pricing
View Details
Vinculin Monoclonal Antibody
AN005300L-01 25 µL

Vinculin Monoclonal Antibody

Sign In for Pricing
View Details
Vinculin Monoclonal Antibody
AN005300L-02 100 µL

Vinculin Monoclonal Antibody

Sign In for Pricing
View Details
Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C2]
TA500573BM 100 µL

Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C2]

Sign In for Pricing
View Details