Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF

Fibroblast Growth Factors-23 (FGF-23) is a 28 kDa member of the fibroblast Growth Factors with 251 amino acid residues. FGF-23 is expressed from brain, hepatic stellate cells, cone photoreceptor cells, early spermatids. FGF-23 involved phosphate metabolism and vitamin D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.

Product Specifications

Synonyms

FGFN

Gene Name

FGF23

UniProt

Q9GZV9

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in BaF3 cells transfected with human FGFRIIIc. The ED50 for this effect is <0.3 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 26.27 kDa. The protein migrates as 26 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI with polyhistidine tag at the C-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

ESR1 isoform1, CT (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1) (FITC) discontinued
035233-FITC 200 µL

ESR1 isoform1, CT (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Protein A/G-Cys
MBS145686-01 1 mg

Recombinant Protein A/G-Cys

Sign In for Pricing
View Details
Recombinant Protein A/G-Cys
MBS145686-02 10 mg

Recombinant Protein A/G-Cys

Sign In for Pricing
View Details
Recombinant Protein A/G-Cys
MBS145686-03 100 mg

Recombinant Protein A/G-Cys

Sign In for Pricing
View Details
Recombinant Protein A/G-Cys
MBS145686-04 5x 100 mg

Recombinant Protein A/G-Cys

Sign In for Pricing
View Details
CYB5R3 (NM_001171660) Human Tagged Lenti ORF Clone
RC229902L3 10 µg

CYB5R3 (NM_001171660) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details