Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-21 (Interleukin-21) protein, AF

Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family, which exerts pleiotropic immune regulations. IL-21 produced primarily by natural killer T (NKT) cells, T follicular helper (TFH) cells and TH17 cells. As a pleiotropic cytokine, IL-21 has been shown to regulate both innate and humoral immunity. It has potent inhibitory activity towards the activation and maturation of granulocyte-macrophage colony-stimulating factor (GM-CSF) -induced dendritic cells (DCs) . In B cells, IL-21 has a major role in the development of immunoglobulin responses. In T cells, it is required to facilitate the functional differentiation of several CD4+ T cell subsets. In addition, the ability of IL-21 to enhance the cytotoxic activity of both CD8+ T cells and NK cells makes it as a potential antitumor agent.

Product Specifications

Synonyms

Za11

Gene Name

IL21

UniProt

Q9ES17

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IL-21 is > 1.6 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 15.9 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5M13P 3'UTR Lenti-reporter-Luc Vector
35463081 1.0 µg

OR5M13P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
BRIX1 Rabbit pAb
E2514481 100 µL

BRIX1 Rabbit pAb

Sign In for Pricing
View Details
IFNB1 Antibody : FITC (OAPB00536-FITC)
OAPB00536-100UG-FITC 0.1 mg

IFNB1 Antibody : FITC (OAPB00536-FITC)

Sign In for Pricing
View Details
NFKBIB (7B4) Antibody
253042 0.1 mL

NFKBIB (7B4) Antibody

Sign In for Pricing
View Details
ORMDL2 ORF Vector (Human) (pORF)
ORF007404 1.0 µg DNA

ORMDL2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rat Hepcidin (Hepcidin) ELISA Kit
orb2812697-01 48 Tests

Rat Hepcidin (Hepcidin) ELISA Kit

Sign In for Pricing
View Details