Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF

Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins and makes the bone marrow produce more white blood cells so it can reduce the risk of infection after some types of cancer treatment also is an established useful clinical agent for increasing neutrophilic granulocytes levels. G-CSF is a 18.67 kDa protein having 207 amino acid which secreted by monocytes, macrophages, fibroblasts, and endothelial cells, regulates cell growth, maturation, development of myeloid cells.

Product Specifications

Synonyms

CSF-3, MGI-1G, GM-CSF beta, pluripoietin

Gene Name

CSF3R

UniProt

Q99062

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <50 pg/mL. The specific activity of recombinant human G-CSF is > 2 x 107 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.48 kDa. The protein migrates as 21kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP with polyhistidine tag at the N-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

DMC1 Polyclonal Conjugated Antibody
MBS9441751-01 0.1 mL (Biotin)

DMC1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DMC1 Polyclonal Conjugated Antibody
MBS9441751-02 0.1 mL (AF350)

DMC1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DMC1 Polyclonal Conjugated Antibody
MBS9441751-03 0.1 mL (AF405)

DMC1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DMC1 Polyclonal Conjugated Antibody
MBS9441751-04 0.1 mL (AF488)

DMC1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DMC1 Polyclonal Conjugated Antibody
MBS9441751-05 0.1 mL (AF555)

DMC1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DMC1 Polyclonal Conjugated Antibody
MBS9441751-06 0.1 mL (AF594)

DMC1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details