Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF

Bone morphogenetic protein 16 (BMP-16) predicts a molecular mass of 18 kDa. BMPs are multi-functional Growth Factorss that belong to the transforming Growth Factors beta (TGF-β) superfamily. BMPs initiate signaling from the cell surface by binding to two different receptors (R: Type I and II) . The heterodimeric formation of type I R and II R may occur before or after BMP binding, inducing signal transduction pathways through SMADs.

Product Specifications

Synonyms

Nodal

Gene Name

NODAL

UniProt

Q96S42

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <2.2 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.75 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD62L (L-Selectin) (CD62L/1588), CF568 conjugate, 0.1mg/mL
BNC681588-500 1x 500 µL

CD62L (L-Selectin) (CD62L/1588), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GNA14 (N-term) Rabbit Polyclonal Antibody
AP51871PU-N 400 µL

GNA14 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C1QTNF12 (NM_001014980) Human Over-expression Lysate
LY423100 100 µg

C1QTNF12 (NM_001014980) Human Over-expression Lysate

Sign In for Pricing
View Details
ART5 (NM_001079536) Human Over-expression Lysate
LY421524 100 µg

ART5 (NM_001079536) Human Over-expression Lysate

Sign In for Pricing
View Details
Iapp Mouse Gene Knockout Kit (CRISPR)
KN308061RB 1 Kit

Iapp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SRC Rabbit Polyclonal Antibody
TA385316 100 µL

SRC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details