Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-17F (Interleukin-17F) protein, AF

Interleukin 17F (IL-17F) predicts a molecular mass of 30.1 kDa, is a cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. It is involved in the development of inflammation and host defense against infection by inducing the expression of genes that encode other proinflammatory cytokines, such as tumor necrosis factor, interleukin 1, interleukin 6 and some members of the colony-stimulating factor family.

Product Specifications

Synonyms

CANDF6, IL-17F, ML-1, ML1

Gene Name

IL17F

UniProt

Q96PD4

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <20 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium acetate, pH 4.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 15.84 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human CD19 Antibody[CB19]
E-AB-F1004M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD19 Antibody[CB19]
E-AB-F1004M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD19 Antibody[CB19]
E-AB-F1004M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
Human DCSTAMP activation kit by CRISPRa
GA113047 1 Kit

Human DCSTAMP activation kit by CRISPRa

Sign In for Pricing
View Details
CHCHD3 Human Gene Knockout Kit (CRISPR)
KN400174 1 Kit

CHCHD3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tapasin Related Protein (TAPBPL) Human Gene Knockout Kit (CRISPR)
KN401899 1 Kit

Tapasin Related Protein (TAPBPL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details