Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant FGF-14 (Fibroblast growth factor-14) protein, AF

Fibroblast Growth Factors-14 (FGF-14) is a 27.7 kDa member of the fibroblast Growth Factors with 247 amino acid residues. FGF-14 is mainly expressed from brain, cervix. FGF-14 involved in nervous system development and function. May regulate voltage-gated sodium channels transport and function.

Product Specifications

Synonyms

FHF-4, FHF4, SCA27

Gene Name

FGF14

UniProt

Q92915

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <21 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 28.28 kDa. The protein migrates as 33 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

AAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKT with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Live-or-DyeTM 488/515 Fixable Viability Staining Kit, Trial Size (50 assays)
#32004-T 1 Kit

Live-or-DyeTM 488/515 Fixable Viability Staining Kit, Trial Size (50 assays)

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (CD4/3027), CF647 conjugate, 0.1mg/mL
BNC473027-500 1x 500 µL

CD4 (T-Helper/Inducer Cell Marker) (CD4/3027), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ATF7-NPFF activation kit by CRISPRa
GA120095 1 Kit

Human ATF7-NPFF activation kit by CRISPRa

Sign In for Pricing
View Details
Hemoglobin (Human) Gel Immobilized Proteins
PG-003-5 5 mL

Hemoglobin (Human) Gel Immobilized Proteins

Sign In for Pricing
View Details
CD41-CD61 Complex Mouse Monoclonal Antibody [Clone ID: 11C3]
AM05550PE-N 100 Tests

CD41-CD61 Complex Mouse Monoclonal Antibody [Clone ID: 11C3]

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF488A conjugate, 0.1mg/mL
BNC882717-100 1x 100 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details