Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-25 (Interleukin-25) protein, AF

Interleukin 25 (IL-25) is a cytokine with proinflammatory and anti-inflammatory effects, it predicts a molecular mass of 16.7 kDa. It can induce NF-κB activation, and stimulate the production of IL-8, which is the major chemotactic substance of neutrophils.

Product Specifications

Synonyms

IL-17E, Il17e

Gene Name

IL25

UniProt

Q8VHH8

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measured by its ability to induce CXCL1 secretion in HT‐29 cells. The ED50 for this effect is <1 ng/mL

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.41kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amer3 Mouse Gene Knockout Kit (CRISPR)
KN501189 1 Kit

Amer3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mcur1 Rabbit Polyclonal Antibody
ER1902-30 100 µL

Mcur1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Unconjugated Rabbit Anti-PNA Antibody
AL-2301-2 2 mL

Unconjugated Rabbit Anti-PNA Antibody

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF594 conjugate, 0.1mg/mL
BNC942598-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NFKB1 Human Gene Knockout Kit (CRISPR)
KN208384RB 1 Kit

NFKB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CES2 (NM_198061) Human Recombinant Protein
TP323021L 1 mg

CES2 (NM_198061) Human Recombinant Protein

Sign In for Pricing
View Details