Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-36 gamma (Interleukin-36 gamma) protein, AF

Interleukin 36 gamma (IL-36 gamma) is a 17.65 kDa cytokine with 159 amino acid residues. IL-36 gamma is a member of the IL-1 family and is mainly expressed in keratinocytes, bronchial epithelial cells, macrophages, and monocyte. This cytokine responds to multiple pathogen-associated molecular patterns (PAMPs) and participates in the inflammatory response. In addition, it also induces the production of pro-inflammatory cytokines like IL-12, IL-1β, IL-6, TNF-α, and IL-23.

Product Specifications

Synonyms

Interleukin 1 family, member 9, IL-1F9, Il36g

Gene Name

IL36G

UniProt

Q8R460

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 104 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.27 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS with polyhistidine tag at the C-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

PGM2L1 Antibody
A59186-100UG 100 µg

PGM2L1 Antibody

Sign In for Pricing
View Details
TRAFD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2433605 3x 1.0 µg

TRAFD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal RPL37A Antibody
NBP2-49441 0.1 mL

Rabbit Polyclonal RPL37A Antibody

Sign In for Pricing
View Details
SRGN Peptide - middle region
MBS3230174-01 0.1 mg

SRGN Peptide - middle region

Sign In for Pricing
View Details
SRGN Peptide - middle region
MBS3230174-02 5x 0.1 mg

SRGN Peptide - middle region

Sign In for Pricing
View Details
Mouse Monoclonal PP5 Antibody (OTI2E12) [Dylight 594]
NBP2-73555DL594 0.1 mL

Mouse Monoclonal PP5 Antibody (OTI2E12) [Dylight 594]

Sign In for Pricing
View Details