Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-36 gamma (Interleukin-36 gamma) protein, AF

Interleukin 36 gamma (IL-36 gamma) is a 17.65 kDa cytokine with 159 amino acid residues. IL-36 gamma is a member of the IL-1 family and is mainly expressed in keratinocytes, bronchial epithelial cells, macrophages, and monocyte. This cytokine responds to multiple pathogen-associated molecular patterns (PAMPs) and participates in the inflammatory response. In addition, it also induces the production of pro-inflammatory cytokines like IL-12, IL-1β, IL-6, TNF-α, and IL-23.

Product Specifications

Synonyms

Interleukin 1 family, member 9, IL-1F9, Il36g

Gene Name

IL36G

UniProt

Q8R460

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 104 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.27 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS with polyhistidine tag at the C-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ROR1 Alexa Fluor 488 MAb (1011919)
FAB20001G-100UG 100 µg

Human ROR1 Alexa Fluor 488 MAb (1011919)

Sign In for Pricing
View Details
TRNAC29 sgRNA CRISPR Lentivector (Human) (Target 1)
K2479602 1.0 µg DNA

TRNAC29 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human NPY (Neuropeptide Y) ELISA Kit
EK241952 96 Well

Human NPY (Neuropeptide Y) ELISA Kit

Sign In for Pricing
View Details
RNA-easy Isolation Reagent
R701-01 100 mL

RNA-easy Isolation Reagent

Sign In for Pricing
View Details
PKAT5-Fluc-SV40-hRluc-Neo Plasmid
PVT76717 2 µg

PKAT5-Fluc-SV40-hRluc-Neo Plasmid

Sign In for Pricing
View Details
IQCJ Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-6102R-BF488 100 µL

IQCJ Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details