Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-28B (Interleukin-28B) protein, AF

Interleukin-28B (IL-28B, now known as Interferon Lambda 3, IFN-λ3) is a 19.77 kDa member of type III IFN family with 176 amino acid residues. IL-28B is expressed by epithelial tissues. Cytokine with antiviral, antitumor and immunomodulatory activities. Able to activate JAK/STAT signaling pathway via binding its receptor IFNLR1 in epithelial cells.

Product Specifications

Synonyms

Interferon lambda 3, IFNL3, IFN-lambda-3, IFN-lambda-4, IL-28C, IL28C

Gene Name

IFNL3

UniProt

Q8IZI9

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 25.57 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI 3 Kinase catalytic subunit alpha (PIK3CA) Human Gene Knockout Kit (CRISPR)
KN213112 1 Kit

PI 3 Kinase catalytic subunit alpha (PIK3CA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LMO2 (B-Cell Marker) (LMO2/3147R), CF740 conjugate, 0.1mg/mL
BNC743147-100 1x 100 µL

LMO2 (B-Cell Marker) (LMO2/3147R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DYNLRB1 (NM_014183) Human Over-expression Lysate
LY402287 100 µg

DYNLRB1 (NM_014183) Human Over-expression Lysate

Sign In for Pricing
View Details
NTE (PNPLA6) (C-term) Rabbit Polyclonal Antibody
AP53371PU-N 400 µL

NTE (PNPLA6) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
6,7-Dichloro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester
TRC-D445118-500MG 500 mg

6,7-Dichloro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
FastClick™ XFD488 Alkyne
72875-AAT 1 mg

FastClick™ XFD488 Alkyne

Sign In for Pricing
View Details