Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-29 (Interleukin-29) protein, AF

Interleukin 29 (IL-29) is a cytokine, predicts a molecular mass of 21.9 kDa. It belongs to type III interferons group, also termed interferons λ (IFN-λ) . Its induction of STAT3-STAT5 has also been displayed, albeit to a lesser degree. The STAT1 /STAT2 signaling cascade transpires as follows: once tyrosine residues on STAT1 and STAT2 are phosphorylated, these proteins dimerize and are subsequently transported to the nucleus.

Product Specifications

Synonyms

IFN-λ1

Gene Name

IFNL1

UniProt

Q8IU54

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in HuH7 cells. The ED50 for this effect is <6 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.70 kDa. The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sprouty 3 (SPRY3) Rabbit Polyclonal Antibody
TA369368 100 µL

Sprouty 3 (SPRY3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KIAA1543 (CAMSAP3) Rabbit Polyclonal Antibody
TA368629 100 µL

KIAA1543 (CAMSAP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ephrin B1 (EFNB1) (NM_004429) Human Over-expression Lysate
LY401409 100 µg

Ephrin B1 (EFNB1) (NM_004429) Human Over-expression Lysate

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF647 conjugate, 0.1mg/mL
BNC471537-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), 0.2mg/mL
BNUB0507-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), 0.2mg/mL

Sign In for Pricing
View Details
3830406C13Rik (BC057656) Mouse Tagged ORF Clone
MG200681 10 µg

3830406C13Rik (BC057656) Mouse Tagged ORF Clone

Sign In for Pricing
View Details