Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-29 (Interleukin-29) protein, AF

Interleukin 29 (IL-29) is a cytokine, predicts a molecular mass of 21.9 kDa. It belongs to type III interferons group, also termed interferons λ (IFN-λ) . Its induction of STAT3-STAT5 has also been displayed, albeit to a lesser degree. The STAT1 /STAT2 signaling cascade transpires as follows: once tyrosine residues on STAT1 and STAT2 are phosphorylated, these proteins dimerize and are subsequently transported to the nucleus.

Product Specifications

Synonyms

IFN-λ1

Gene Name

IFNL1

UniProt

Q8IU54

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in HuH7 cells. The ED50 for this effect is <6 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.70 kDa. The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N’-Nitrosonornicotine N-D-Glucoside Chloride Salt (Mixture Of Diastereomers)
TRC-N573770-2.5MG 2.5 mg

N’-Nitrosonornicotine N-D-Glucoside Chloride Salt (Mixture Of Diastereomers)

Sign In for Pricing
View Details
MEIS2 Human Gene Knockout Kit (CRISPR)
KN401395 1 Kit

MEIS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-100 1x 100 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ADRP (Adipose Differentiation Related Protein) CLIA Kit
E-CL-H0230-01 24 Tests

Human ADRP (Adipose Differentiation Related Protein) CLIA Kit

Sign In for Pricing
View Details
Human ADRP (Adipose Differentiation Related Protein) CLIA Kit
E-CL-H0230-02 48 Tests

Human ADRP (Adipose Differentiation Related Protein) CLIA Kit

Sign In for Pricing
View Details
Human ADRP (Adipose Differentiation Related Protein) CLIA Kit
E-CL-H0230-03 96 Tests

Human ADRP (Adipose Differentiation Related Protein) CLIA Kit

Sign In for Pricing
View Details