Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant CXCL16 (C-X-C motif chemokine 16) protein, AF

C-X-C motif chemokine 16 (CXCL16) is a chemokine of the intercrine alpha family which is a 9.8 kDa protein containing 88 amino acid residues. In mediate the innate immunity, CXCL16 is a chemotaxis for T cells and NKT cells, which expressed the CXC chemokine receptor (CXCR) 6. CXCL16 also can be enhanced the expression level by the TNFα, IL-1 and IFNγ. CXCL16 protects the host by against the gram positive and gram negitive bactreials.

Product Specifications

Synonyms

SRPSOX

Gene Name

CXCL16

UniProt

Q8BSU2

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR6 The ED50 for this effect is <3 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 10.74 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-500 1x 500 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL
BNC400853-100 1x 100 µL

P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL
BNC470844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details