Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-8a (Bone morphogenetic protein-8a) protein, AF

Bone Morphogenetic Protein-8 (BMP-8) is an extracellular multifunctional cytokine that is also a member of the TGF-β family. BMP-8 can bind with TGF-β receptor and is involved in SMAD protein signal transduction. In addition, BMP-8 participates in the downregulation of insulin secretion that lets the heat stabilize. Moreover, it participates in ossification and is essential to cartilage and hard bone development.

Product Specifications

Synonyms

BMP-8, OP-2, Osteogenic Protein-2

Gene Name

BMP8A

UniProt

Q7Z5Y6

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 10-19.4 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 16.61 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POSTN Polyclonal Antibody
D-AB-10363L-01 25 µL

POSTN Polyclonal Antibody

Sign In for Pricing
View Details
POSTN Polyclonal Antibody
D-AB-10363L-02 100 µL

POSTN Polyclonal Antibody

Sign In for Pricing
View Details
VU 0422288
TRC-V787590-50MG 50 mg

VU 0422288

Sign In for Pricing
View Details
Disperse Yellow 9 (Technical Grade)
TRC-D995360-2.5G 2.5 g

Disperse Yellow 9 (Technical Grade)

Sign In for Pricing
View Details
PROCR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E12]
TA805528BM 100 µL

PROCR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E12]

Sign In for Pricing
View Details
Stub1 Mouse Gene Knockout Kit (CRISPR)
KN516920 1 Kit

Stub1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details