Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-8a (Bone morphogenetic protein-8a) protein, AF

Bone Morphogenetic Protein-8 (BMP-8) is an extracellular multifunctional cytokine that is also a member of the TGF-β family. BMP-8 can bind with TGF-β receptor and is involved in SMAD protein signal transduction. In addition, BMP-8 participates in the downregulation of insulin secretion that lets the heat stabilize. Moreover, it participates in ossification and is essential to cartilage and hard bone development.

Product Specifications

Synonyms

BMP-8, OP-2, Osteogenic Protein-2

Gene Name

BMP8A

UniProt

Q7Z5Y6

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 10-19.4 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 16.61 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K2 Rabbit Polyclonal Antibody (BF647)
orb2401683 100 µL

MAP3K2 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Anti-Doublecortin Like Kinase 1 (DCLK1)
FY-AB48075-01 1 mL

Anti-Doublecortin Like Kinase 1 (DCLK1)

Sign In for Pricing
View Details
Anti-Doublecortin Like Kinase 1 (DCLK1)
FY-AB48075-02 100 µL

Anti-Doublecortin Like Kinase 1 (DCLK1)

Sign In for Pricing
View Details
Anti-Doublecortin Like Kinase 1 (DCLK1)
FY-AB48075-03 200 µL

Anti-Doublecortin Like Kinase 1 (DCLK1)

Sign In for Pricing
View Details
Olr742 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
34644156 3x 1.0 µg DNA

Olr742 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
AF-10 (MLLT10, AF10, Protein AF-10, ALL1-fused gene from chromosome 10 protein) discontinued
341740-01 100 µL

AF-10 (MLLT10, AF10, Protein AF-10, ALL1-fused gene from chromosome 10 protein) discontinued

Sign In for Pricing
View Details