Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-8a (Bone morphogenetic protein-8a) protein, AF

Bone Morphogenetic Protein-8 (BMP-8) is an extracellular multifunctional cytokine that is also a member of the TGF-β family. BMP-8 can bind with TGF-β receptor and is involved in SMAD protein signal transduction. In addition, BMP-8 participates in the downregulation of insulin secretion that lets the heat stabilize. Moreover, it participates in ossification and is essential to cartilage and hard bone development.

Product Specifications

Synonyms

BMP-8, OP-2, Osteogenic Protein-2

Gene Name

BMP8A

UniProt

Q7Z5Y6

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 10-19.4 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 16.61 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLI1 Antibody - middle region : Biotin (P100882_P050-Biotin)
P100882_P050-Biotin 100 µL

FLI1 Antibody - middle region : Biotin (P100882_P050-Biotin)

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum aroK Protein (aa 1-170) (strain 657 / Type Ba4)
VAng-Lsx7967-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Botulinum aroK Protein (aa 1-170) (strain 657 / Type Ba4)

Sign In for Pricing
View Details
Recombinant Mouse UQCC Protein, His (Fc)-Avi-tagged
UQCC-9932M 50 µg

Recombinant Mouse UQCC Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Histone H3, acetylated (Lys18)
H5110-13E 100 µL

Histone H3, acetylated (Lys18)

Sign In for Pricing
View Details
GRIK3 (GLUR7, Glutamate Receptor, Ionotropic Kainate 3, Excitatory Amino Acid Receptor 5, EAA5, Glutamate Receptor 7, GluR-7, GluR7) (HRP)
127543-HRP 100 µL

GRIK3 (GLUR7, Glutamate Receptor, Ionotropic Kainate 3, Excitatory Amino Acid Receptor 5, EAA5, Glutamate Receptor 7, GluR-7, GluR7) (HRP)

Sign In for Pricing
View Details
FGF8 (Fibroblast Growth Factor 8 (androgen-Induced), AIGF, HBGF-8, MGC149376) (HRP)
246086-HRP 100 µL

FGF8 (Fibroblast Growth Factor 8 (androgen-Induced), AIGF, HBGF-8, MGC149376) (HRP)

Sign In for Pricing
View Details