Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-12 (Bone morphogenetic protein-12) protein, AF

Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. BMP-12 regulates chondrogenesis, bone morphogenesis, and neuron differentiation.

Product Specifications

Synonyms

Growth/Differentiation Factor-7, GDF-7

Gene Name

GDF7

UniProt

Q7Z4P5

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 2 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.95 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RLIMP2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV742827 1.0 µg DNA

RLIMP2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Lysozyme (LYZ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]
TA506191AM 100 µL

Lysozyme (LYZ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]

Sign In for Pricing
View Details
CD171 (NCAM-L1, CAML1, HSAS1, Hyd, L1 Cell Adhesion Molecule, L1-NCAM, MASA, MIC5, NCAM-L1, Nerve-growth factor-inducible large external GlycoProtein, Neural cell Adhesion Molecule L1, NILE, S10, SPG1) (PE)
MBS6123921-01 0.1 mL

CD171 (NCAM-L1, CAML1, HSAS1, Hyd, L1 Cell Adhesion Molecule, L1-NCAM, MASA, MIC5, NCAM-L1, Nerve-growth factor-inducible large external GlycoProtein, Neural cell Adhesion Molecule L1, NILE, S10, SPG1) (PE)

Sign In for Pricing
View Details
CD171 (NCAM-L1, CAML1, HSAS1, Hyd, L1 Cell Adhesion Molecule, L1-NCAM, MASA, MIC5, NCAM-L1, Nerve-growth factor-inducible large external GlycoProtein, Neural cell Adhesion Molecule L1, NILE, S10, SPG1) (PE)
MBS6123921-02 5x 0.1 mL

CD171 (NCAM-L1, CAML1, HSAS1, Hyd, L1 Cell Adhesion Molecule, L1-NCAM, MASA, MIC5, NCAM-L1, Nerve-growth factor-inducible large external GlycoProtein, Neural cell Adhesion Molecule L1, NILE, S10, SPG1) (PE)

Sign In for Pricing
View Details
Mouse Monoclonal Serpin A6/Cortisol Binding Globulin Antibody (06) [Alexa Fluor 488]
NBP3-06555AF488 0.1 mL

Mouse Monoclonal Serpin A6/Cortisol Binding Globulin Antibody (06) [Alexa Fluor 488]

Sign In for Pricing
View Details
Angiopoietin-1 receptor Phospho-Tyr1108 (TEK pY1108) Antibody
abx325688-01 50 µg

Angiopoietin-1 receptor Phospho-Tyr1108 (TEK pY1108) Antibody

Sign In for Pricing
View Details