Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-16 (aa 2-130) (Interleukin-16) protein, AF

Interleukin 16 (IL-16) predicts a molecular mass of 13.5 kDa, encoded by this gene is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication, and signaling process of this cytokine is mediated by CD4.

Product Specifications

Synonyms

LCF (Lymphocyte Chemoattractant Factor)

Gene Name

IL16

UniProt

Q14005

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.12 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p60 CAF1 (CHAF1B) Human Gene Knockout Kit (CRISPR)
KN402858 1 Kit

p60 CAF1 (CHAF1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GF-1 Gel DNA Recovery Kit, 50 preps
GF-GP-050 50 Preparations

GF-1 Gel DNA Recovery Kit, 50 preps

Sign In for Pricing
View Details
TGF alpha (TGFA) Human Gene Knockout Kit (CRISPR)
KN202741LP 1 Kit

TGF alpha (TGFA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
REC8 (NM_005132) Human Over-expression Lysate
LY401575 100 µg

REC8 (NM_005132) Human Over-expression Lysate

Sign In for Pricing
View Details
Human FGF22 activation kit by CRISPRa
GA108963 1 Kit

Human FGF22 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: carotid
CS510491 5x 5 µm

Frozen Tissue Sections, Artery: carotid

Sign In for Pricing
View Details