Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant Noggin protein, AF

Noggin is a 46.2 kDa bioactive protein, which exists as a disulfide-linked homodimer (each chain 23.1 kDa) . Noggin binds members of the transforming Growth Factors-beta (TGF beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP-4), which inactivates their activities. As a extracellular antagonist of BMP proteins, Noggin involves in the development of many body tissues, including nerve tissue, muscles, and bones. In addition, Noggin is able to inhibit chondrocyte differentiation through its interaction with GDF5.

Product Specifications

Synonyms

NOG, Noggin, SYM1, symphalangism 1 (proximal), synostoses (multiple) syndrome 1, SYNS1, SYNS1A

Gene Name

NOG

UniProt

Q13253

Reactivity

Human

Tag

Fc Tag (C-term)

Source

HEK293 cell

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <0.05 μg/mL in the presence of 50 ng/mL of recombinant human BMP-4.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 49.11 kDa. The protein migrates as 58 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC with Fc tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-9 Antibody - C-terminal
OAPB01805-100UG 0.1 mg

IL-9 Antibody - C-terminal

Sign In for Pricing
View Details
XAGE3 Protein Vector (Human) (pPM-C-His)
PV046528 500 ng

XAGE3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CYP26C1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0556207 1.0 µg DNA

CYP26C1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Hepatitis C HCV NS4 a+b Protein, Biotin, E.coli-100ug
QP12178-B-100ug 100ug

Recombinant Hepatitis C HCV NS4 a+b Protein, Biotin, E.coli-100ug

Sign In for Pricing
View Details
Human MRPL36 qPCR Primer Pair
QH50601S 200 Tests

Human MRPL36 qPCR Primer Pair

Sign In for Pricing
View Details
FAM120C 3'UTR GFP Stable Cell Line
TU254254 1.0 mL

FAM120C 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details