Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant Activin B protein, AF

Activin B is the cytokine of the TGF beta family, which is a 12.9 kDa protein containing 116 amino acid residues. Activin B has the wide variety of biological function including stem cell differentiation, inflammation, bone remodeling and neural development. It also has a role in regulation of FSH secretion. Activin B induces the phosphorylation of Smad which binds the smad binding element.

Product Specifications

Synonyms

Activin Beta B; Activin beta-B chain; INHBB; inhibin beta B

Gene Name

Inhbb

UniProt

Q04999

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <1 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.71 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGLECDGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adamantane-1-carboxylic acid
OR28762-01 25 g

Adamantane-1-carboxylic acid

Sign In for Pricing
View Details
Adamantane-1-carboxylic acid
OR28762-02 100 g

Adamantane-1-carboxylic acid

Sign In for Pricing
View Details
Adamantane-1-carboxylic acid
OR28762-03 500 g

Adamantane-1-carboxylic acid

Sign In for Pricing
View Details
Factor XIII B discontinued
347889-01 100 µL

Factor XIII B discontinued

Sign In for Pricing
View Details
Factor XIII B discontinued
347889-02 200 µL

Factor XIII B discontinued

Sign In for Pricing
View Details
NUDT7 sgRNA CRISPR Lentivector (Human) (Target 3)
K1464704 1.0 µg DNA

NUDT7 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details