Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant Activin B protein, AF

Activin B is the cytokine of the TGF beta family, which is a 12.9 kDa protein containing 116 amino acid residues. Activin B has the wide variety of biological function including stem cell differentiation, inflammation, bone remodeling and neural development. It also has a role in regulation of FSH secretion. Activin B induces the phosphorylation of Smad which binds the smad binding element.

Product Specifications

Synonyms

Activin Beta B; Activin beta-B chain; INHBB; inhibin beta B

Gene Name

Inhbb

UniProt

Q04999

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <1 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.71 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGLECDGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BpuMI, 500U
RV1162 500 U

BpuMI, 500U

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C3), CF740 conjugate, 0.1mg/mL
BNC740354-100 1x 100 µL

AFP (Alpha Fetoprotein) (C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OPN1SW Human Gene Knockout Kit (CRISPR)
KN422804 1 Kit

OPN1SW Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS700756 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Anti-C-reactive protein antibody *Mouse anti-human, monoclonal IgG*
V100145-AAT 50 µg

Anti-C-reactive protein antibody *Mouse anti-human, monoclonal IgG*

Sign In for Pricing
View Details
(1R)-(-)-2-Azabicyclo[2.2.1]hept-5-en-3-one
TRC-A795205-5G 5 g

(1R)-(-)-2-Azabicyclo[2.2.1]hept-5-en-3-one

Sign In for Pricing
View Details