Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF

Vascular Endothelial Growth Factors 165 (VEGF165) is a potent growth and angiogenic cytokine which belongs to the VEGF family, includes VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. VEGF165 is an abundant glycosylated cytokine composed of two identical 165 amino acid chains. VEGF165 plays an important role in embryonic vasculogenesis, angiogenesis and neurogenesis.

Product Specifications

Synonyms

VPF, Folliculostellate cell-derived growth factor, Glioma-derived endothelial cell mitogen

Gene Name

VEGFA

UniProt

Q00731

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <3 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.22 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ileum
CS625962 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
6-Chloropurine, Hydrochloride
TRC-C379855-25G 25 g

6-Chloropurine, Hydrochloride

Sign In for Pricing
View Details
Argininosuccinate Lyase (ASL) (NM_000048) Human Over-expression Lysate
LY424953 100 µg

Argininosuccinate Lyase (ASL) (NM_000048) Human Over-expression Lysate

Sign In for Pricing
View Details
Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), CF640R conjugate, 0.1mg/mL
BNC403025-100 1x 100 µL

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CYB5R1 (NM_016243) Human Over-expression Lysate
LC402525 20 µg

CYB5R1 (NM_016243) Human Over-expression Lysate

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details