Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF

Vascular Endothelial Growth Factors 165 (VEGF165) is a potent growth and angiogenic cytokine which belongs to the VEGF family, includes VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. VEGF165 is an abundant glycosylated cytokine composed of two identical 165 amino acid chains. VEGF165 plays an important role in embryonic vasculogenesis, angiogenesis and neurogenesis.

Product Specifications

Synonyms

VPF, Folliculostellate cell-derived growth factor, Glioma-derived endothelial cell mitogen

Gene Name

VEGFA

UniProt

Q00731

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <3 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.22 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSM11 Mouse Monoclonal Antibody [Clone ID: OTI1F1]
CF809990 100 µg

LSM11 Mouse Monoclonal Antibody [Clone ID: OTI1F1]

Sign In for Pricing
View Details
Recombinant Mouse IL1R2/CD121b Protein (His Tag)
PKSM040367-01 100 µg

Recombinant Mouse IL1R2/CD121b Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL1R2/CD121b Protein (His Tag)
PKSM040367-02 1 mg

Recombinant Mouse IL1R2/CD121b Protein (His Tag)

Sign In for Pricing
View Details
1-Pentyl-3-(4-ethyl-naphthoyl)indole JWH 210 (1.0mg/ml in Acetonitrile)
TRC-KIT6885-5X1ML 5x 1 mL

1-Pentyl-3-(4-ethyl-naphthoyl)indole JWH 210 (1.0mg/ml in Acetonitrile)

Sign In for Pricing
View Details
MTHFD2 Antibody
KC-910-01 50 μL

MTHFD2 Antibody

Sign In for Pricing
View Details
MTHFD2 Antibody
KC-910-02 100 µL

MTHFD2 Antibody

Sign In for Pricing
View Details