Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant Neurturin protein, AF

Neurturin is a 22 kDa cytokine with 195 amino acid residues. Neurturin belongs to the same neurotrophic factor family as GDNF. Binding to GFRα-2 (GPI-linked receptor termed GDNF family receptor α-2), neurturin activates Ret receptor tyrosine kinase and MAPK pathway. It involves in neuron survival.

Product Specifications

Synonyms

NTN, NRTN

Gene Name

Nrtn

UniProt

P97463

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in SH-SY5Y cells. The ED50 for this effect is <50 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 12.33 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Probable E3 Ubiquitin-Protein Ligase Makorin-3 (MKRN3) ELISA Kit
MBS9352437-01 48 Well

Bovine Probable E3 Ubiquitin-Protein Ligase Makorin-3 (MKRN3) ELISA Kit

Sign In for Pricing
View Details
Bovine Probable E3 Ubiquitin-Protein Ligase Makorin-3 (MKRN3) ELISA Kit
MBS9352437-02 96 Well

Bovine Probable E3 Ubiquitin-Protein Ligase Makorin-3 (MKRN3) ELISA Kit

Sign In for Pricing
View Details
Bovine Probable E3 Ubiquitin-Protein Ligase Makorin-3 (MKRN3) ELISA Kit
MBS9352437-03 5x 96 Well

Bovine Probable E3 Ubiquitin-Protein Ligase Makorin-3 (MKRN3) ELISA Kit

Sign In for Pricing
View Details
Bovine Probable E3 Ubiquitin-Protein Ligase Makorin-3 (MKRN3) ELISA Kit
MBS9352437-04 10x 96 Well

Bovine Probable E3 Ubiquitin-Protein Ligase Makorin-3 (MKRN3) ELISA Kit

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Cluster Of Differentiation 83 (CD83)
MBS2134001-01 0.1 mL

PE Linked Polyclonal Antibody to Cluster Of Differentiation 83 (CD83)

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Cluster Of Differentiation 83 (CD83)
MBS2134001-02 0.2 mL

PE Linked Polyclonal Antibody to Cluster Of Differentiation 83 (CD83)

Sign In for Pricing
View Details