Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL6 (C-X-C motif chemokine 6) protein, AF

C-X-C motif chemokine 6 (CXCL6) also named granulocyte chemotactic protein 2 (GCP-2), which is a chemokine of the intercrine alpha family. CXCL6 is a 8.3kDa protein containing 75 amino acid residues. CXCL6 has a significant role in resistance of gram-positive and gram-negative bacteria which is a chemotaxis for neutrophil granulocytes. CXCL6 has a role in in the process of carcinogenesis which affects proliferation and metastasis of OS cells by the interaction with CXCR1 /CXCR2.

Product Specifications

Synonyms

Granulocyte Chemotactic Protein-2, GCP-2

Gene Name

CXCL6

UniProt

P80162

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <10 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.97 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

VSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Iqub activation kit by CRISPRa
GA213230 1 Kit

Mouse Iqub activation kit by CRISPRa

Sign In for Pricing
View Details
ILP2 (ILP-2, ILP 2, Inhibitor of Apoptosis Protein (IAP) -like Protein-2) (FITC)
301377-FITC 100 µL

ILP2 (ILP-2, ILP 2, Inhibitor of Apoptosis Protein (IAP) -like Protein-2) (FITC)

Sign In for Pricing
View Details
RAB9A Antibody
A32706-100UL 100 µL

RAB9A Antibody

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila nuoB Protein (aa 1-158)
VAng-Lsx3906-500gEcoli 500 µg (E. coli)

Recombinant Legionella Pneumophila nuoB Protein (aa 1-158)

Sign In for Pricing
View Details
AMBP Antibody (N-term) (Ascites)
AM2100a 100 µL

AMBP Antibody (N-term) (Ascites)

Sign In for Pricing
View Details
SMAGP CRISPRa sgRNA lentivector (set of three targets)(Mouse)
44402124 3x 1.0µg DNA

SMAGP CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details