Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL6 (C-X-C motif chemokine 6) protein, AF

C-X-C motif chemokine 6 (CXCL6) also named granulocyte chemotactic protein 2 (GCP-2), which is a chemokine of the intercrine alpha family. CXCL6 is a 8.3kDa protein containing 75 amino acid residues. CXCL6 has a significant role in resistance of gram-positive and gram-negative bacteria which is a chemotaxis for neutrophil granulocytes. CXCL6 has a role in in the process of carcinogenesis which affects proliferation and metastasis of OS cells by the interaction with CXCR1 /CXCR2.

Product Specifications

Synonyms

Granulocyte Chemotactic Protein-2, GCP-2

Gene Name

CXCL6

UniProt

P80162

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <10 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.97 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

VSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fatty Acid Synthase/FASN ELISA Kit (Colorimetric)
NBP2-82490 1 Kit

Rat Fatty Acid Synthase/FASN ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Troponin I antibody (Cardiac)
MBS531499-01 1 mg

Troponin I antibody (Cardiac)

Sign In for Pricing
View Details
Troponin I antibody (Cardiac)
MBS531499-02 5x 1 mg

Troponin I antibody (Cardiac)

Sign In for Pricing
View Details
PKNOX1 Human Gene Knockout Kit (CRISPR)
KN402916 1 Kit

PKNOX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Beclin 1 Monoclonal Antibody, Cy5 Conjugated
bsm-33323M-Cy5-01 20 µL

Beclin 1 Monoclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Beclin 1 Monoclonal Antibody, Cy5 Conjugated
bsm-33323M-Cy5-02 100 µL

Beclin 1 Monoclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details