Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-18 (Interleukin-18) protein, AF

Interleukin-18 (IL-18) belongs to the IL-1 superfamily and is constitutively produced by macrophages, dendritic cells (DCs) and other cells. IL-18 binds to the receptor of IL-18 (IL-18R) and initiate the recruitment and heterodimerization of the IL-18RAcP, leading to downstream activation of NF-κB. After stimulation with IL-18, multiple cytokines including IFN-γ, IL-13, IL-4, IL-8, and GM-CSF and both Th1 and Th2 lymphokines could be produced by different cells. As an immunoregulaory cytokine, IL-18 can promote development of T helper 1 (Th1) cells, which maximizes the production of IFN by synergistically stimulating to mature Th1 effectors in combination with IL-12. On the contrary, it inhibits the production of the anti-inflammatory cytokine IL-10. In addition, IL-18 exhibits multiple proinflammatory functions, such as increases in cell adhesion molecules, nitric oxide synthesis, and chemokine production.

Product Specifications

Synonyms

IGIF

Gene Name

IL18

UniProt

P70380

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED50 for this effect is <0.5 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.1 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Commd3 activation kit by CRISPRa
GA200456 1 Kit

Mouse Commd3 activation kit by CRISPRa

Sign In for Pricing
View Details
Amplite® Fluorimetric Endotoxin Detection Kit
60006-AAT 100 Tests

Amplite® Fluorimetric Endotoxin Detection Kit

Sign In for Pricing
View Details
Human LOC113230 (MISP3) activation kit by CRISPRa
GA114396 1 Kit

Human LOC113230 (MISP3) activation kit by CRISPRa

Sign In for Pricing
View Details
NEDD4 2 (NEDD4L) Human Gene Knockout Kit (CRISPR)
KN217897RB 1 Kit

NEDD4 2 (NEDD4L) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSPA14 Rabbit Polyclonal Antibody
TA361658 100 µL

HSPA14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Amino-3-Hydroxybutanoic Acid
TRC-A611270-50G 50 g

4-Amino-3-Hydroxybutanoic Acid

Sign In for Pricing
View Details