Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF

Ciliary Neurotrophic Factor (CNTF) is the member of IL-6 cytokine family and mainly expressed in the nervous system. Mouse CNTF shares 84% sequence homology with human CNTF. CNTF is 22.9 kDa neurotrophic factor containing 110 residues, which shows multiple effects in vertebrate retinogenesis. Besides, CNTF acts as a promoter that not only accelerates adult neurogenesis but also increases the survival of neuron after injury.

Product Specifications

Synonyms

AI429687

Gene Name

CNTF

UniProt

P51642

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <10 ng/mL. The specific activity of recombinant mouse CNTF is > 1 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 23.40 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM with polyhistidine tag at the C-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2A5 Double Nickase Plasmid (m)
sc-419905-NIC 20 µg

CYP2A5 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
AKR7A2 Antibody
A12324-50UL 50 μL

AKR7A2 Antibody

Sign In for Pricing
View Details
Inhibitor hsa-miR-3934-3p AAV miRNA Vector
Amh3138700 500 ng

Inhibitor hsa-miR-3934-3p AAV miRNA Vector

Sign In for Pricing
View Details
TM2D2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46790111 3x 1.0 µg

TM2D2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RGD1560286 ORF Vector (Rat) (pORF)
39215017 1.0 µg DNA

RGD1560286 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Lentiviral human FGF13 shRNA (UAS) - Lentiviral human FGF13 shRNA (UAS, iRFP) (100)
GTR15347226 1 Vial

Lentiviral human FGF13 shRNA (UAS) - Lentiviral human FGF13 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details